SCOPe 2.06: Domain d1rkla_: 1rkl A:

Lineage for d1rkla_ (1rkl A:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.30: Oligosaccharyltransferase subunit ost4p [103464] (1 family)
   automatically mapped to Pfam PF10215

5. Family f.23.30.1: Oligosaccharyltransferase subunit ost4p [103465] (1 protein)

6. Protein Oligosaccharyltransferase subunit ost4p [103466] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103467] (1 PDB entry)

8. Domain d1rkla_: 1rkl A: [97615]

Details for d1rkla_

PDB Entry: 1rkl

PDB Description: nmr structure of yeast oligosaccharyltransferase subunit ost4p

PDB Compounds: (A:) Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit

SCOPe Domain Sequences for d1rkla_:

Sequence; same for both SEQRES and ATOM records:

>d1rkla_ f.23.30.1 (A:) Oligosaccharyltransferase subunit ost4p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
misdeqlnslaitfgivmmtliviyhavdstmspkn

Timeline for d1rkla_:

• d1rkla_ first appeared in SCOP 1.67
  
• d1rkla_ appears in SCOPe 2.05
  
• d1rkla_ appears in SCOPe 2.07
  
• d1rkla_ appears in the current release, SCOPe 2.08