PDB entry 1rch

View 1rch on RCSB PDB site
Description: solution nmr structure of ribonuclease hi from escherichia coli, 8 structures
Deposited on 1995-06-23, released 1997-02-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: NMR8
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1rch__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rch_ (-)
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev