PDB entry 1rbu

View 1rbu on RCSB PDB site
Description: structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Deposited on 1993-02-16, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1rbu__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rbu_ (-)
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkkrgwktadnkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev