PDB entry 1r8p

View 1r8p on RCSB PDB site
Description: HPV-16 E2C solution structure
Class: transcription
Keywords: dimeric beta-barrel, DNA binding protein, transcription factor
Deposited on 2003-10-28, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulatory protein E2
  Species: Human papillomavirus - 16 [TaxId:333760]
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03120 (1-80)
    • initiating met (0)
  Domains in SCOPe 2.08: d1r8pa_
• Chain 'B':
  Compound: Regulatory protein E2
  Species: Human papillomavirus - 16 [TaxId:333760]
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03120 (1-80)
    • initiating met (0)
  Domains in SCOPe 2.08: d1r8pb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1r8pA (A:)
  mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
  qflsqvkipktitvstgfmsi
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1r8pB (B:)
  mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
  qflsqvkipktitvstgfmsi