SCOPe 2.08: Domain d1r8pa_: 1r8p A:

Lineage for d1r8pa_ (1r8p A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 16 [TaxId:333760] [54962] (5 PDB entries)
   Uniprot P03120 286-365

8. Domain d1r8pa_: 1r8p A: [111720]

Details for d1r8pa_

PDB Entry: 1r8p

PDB Description: hpv-16 e2c solution structure

PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d1r8pa_:

Sequence; same for both SEQRES and ATOM records:

>d1r8pa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]}
mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfmsi

Timeline for d1r8pa_:

• d1r8pa_ first appeared in SCOP 1.71
  
• d1r8pa_ appears in SCOPe 2.07