![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
![]() | Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
![]() | Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
![]() | Species Human papillomavirus type 16 [TaxId:333760] [54962] (5 PDB entries) Uniprot P03120 286-365 |
![]() | Domain d1r8pb_: 1r8p B: [111721] |
PDB Entry: 1r8p (more details)
SCOPe Domain Sequences for d1r8pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8pb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]} mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd qflsqvkipktitvstgfmsi
Timeline for d1r8pb_: