PDB entry 1qso

View 1qso on RCSB PDB site
Description: Histone Acetyltransferase HPA2 from Saccharomyces Cerevisiae
Deposited on 1999-06-22, released 1999-12-22
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.19
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qsoa_
  • Chain 'B':
    Domains in SCOP 1.55: d1qsob_
  • Chain 'C':
    Domains in SCOP 1.55: d1qsoc_
  • Chain 'D':
    Domains in SCOP 1.55: d1qsod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsoA (A:)
    nitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavessse
    kiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvywc
    tdesnhraqllyvkvgykapkilykrkgy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsoB (B:)
    nitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavessse
    kiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvywc
    tdesnhraqllyvkvgykapkilykrkgy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsoC (C:)
    nitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavessse
    kiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvywc
    tdesnhraqllyvkvgykapkilykrkgy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qsoD (D:)
    nitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavessse
    kiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvywc
    tdesnhraqllyvkvgykapkilykrkgy