PDB entry 1qpg

View 1qpg on RCSB PDB site
Description: 3-phosphoglycerate kinase, mutation r65q
Deposited on 1996-01-04, released 1996-06-10
The last revision prior to the SCOP 1.55 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1qpg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpg_ (-)
    slssklsvqdldlkdkrvfirvdfnvpldgkkitsnqrivaalptikyvlehhpryvvla
    shlgqpngernekyslapvakelqsllgkdvtflndcvgpeveaavkasapgsvillenl
    ryhieeegsrkvdgqkvkaskedvqkfrhelssladvyindafgtahrahssmvgfdlpq
    raagfllekelkyfgkalenptrpflailggakvadkiqlidnlldkvdsiiigggmaft
    fkkvlenteigdsifdkagaeivpklmekakakgvevvlpvdfiiadafsadantktvtd
    kegipagwqgldngpesrklfaatvakaktivwngppgvfefekfaagtkalldevvkss
    aagntviigggdtatvakkygvtdkishvstgggaslellegkelpgvaflsekk