PDB entry 1ql2

View 1ql2 on RCSB PDB site
Description: inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Class: virus
Keywords: virus, virus coat protein, helical virus coat protein, ssDNA viruses, inovirus, helical virus
Deposited on 1999-08-20, released 2000-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: FIBER
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pf1 bacteriophage coat protein b
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ql2a_
  • Chain 'B':
    Compound: pf1 bacteriophage coat protein b
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ql2b_
  • Chain 'C':
    Compound: pf1 bacteriophage coat protein b
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ql2c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ql2A (A:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ql2B (B:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ql2C (C:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka