PDB entry 1ql2
View 1ql2 on RCSB PDB site
Description: inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Class: virus
Keywords: virus, virus coat protein, helical virus coat protein, ssDNA viruses, inovirus, helical virus
Deposited on
1999-08-20, released
2000-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: FIBER
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.19
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: pf1 bacteriophage coat protein b
Species: Pseudomonas phage Pf1 [TaxId:10871]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1ql2a_ - Chain 'B':
Compound: pf1 bacteriophage coat protein b
Species: Pseudomonas phage Pf1 [TaxId:10871]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1ql2b_ - Chain 'C':
Compound: pf1 bacteriophage coat protein b
Species: Pseudomonas phage Pf1 [TaxId:10871]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1ql2c_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ql2A (A:)
gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ql2B (B:)
gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1ql2C (C:)
gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka