| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) ![]() |
| Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein) |
| Protein Inovirus (filamentous phage) major coat protein [57989] (8 species) |
| Species Bacteriophage pf1 [TaxId:10871] [57991] (12 PDB entries) Uniprot P03621 |
| Domain d1ql2a_: 1ql2 A: [45554] |
PDB Entry: 1ql2 (more details), 3.1 Å
SCOPe Domain Sequences for d1ql2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ql2a_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage pf1 [TaxId: 10871]}
gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka
Timeline for d1ql2a_: