PDB entry 1ql1

View 1ql1 on RCSB PDB site
Description: inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Deposited on 1999-08-20, released 2000-02-07
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: FIBER
Resolution: 3.1 Å
R-factor: 0.3
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pf1 bacteriophage coat protein b
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ql1A (A:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka