PDB entry 1qey

View 1qey on RCSB PDB site
Description: nmr structure determination of the tetramerization domain of the mnt repressor: an asymmetric a-helical assembly in slow exchange
Deposited on 1999-04-03, released 1999-08-18
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: NMR27
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (regulatory protein mnt)
  Species: Enterobacteria phage P22 [TaxId:10754]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03049 (0-30)
• Chain 'B':
  Compound: protein (regulatory protein mnt)
  Species: Enterobacteria phage P22 [TaxId:10754]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03049 (0-30)
• Chain 'C':
  Compound: protein (regulatory protein mnt)
  Species: Enterobacteria phage P22 [TaxId:10754]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03049 (0-30)
• Chain 'D':
  Compound: protein (regulatory protein mnt)
  Species: Enterobacteria phage P22 [TaxId:10754]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03049 (0-30)

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >1qeyA (A:)
  rndaerladeqselvkkmvfdtlkdlykktt
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >1qeyB (B:)
  rndaerladeqselvkkmvfdtlkdlykktt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >1qeyC (C:)
  rndaerladeqselvkkmvfdtlkdlykktt
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >1qeyD (D:)
  rndaerladeqselvkkmvfdtlkdlykktt