PDB entry 1qbh

View 1qbh on RCSB PDB site
Description: solution structure of a baculoviral inhibitor of apoptosis (iap) repeat
Deposited on 1999-04-20, released 1999-10-20
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-20, with a file datestamp of 1999-10-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1qbha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qbhA (A:)
  gshmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
  wvehakwfprceflirmkgqefvdeiqgryphlleqllsts