PDB entry 1qb6

View 1qb6 on RCSB PDB site
Description: bovine trypsin 3,3'-[3,5-difluoro-4-methyl-2, 6-pyridinediylbis(oxy)]bis(benzenecarboximidamide) (zk-805623) complex
Class: hydrolase
Keywords: hydrolase, serine proteinase, protein-inhibitor complex, s1 pocket, factor xa
Deposited on 1999-04-29, released 2000-04-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (trypsin)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOPe 2.02: d1qb6a_
• Heterogens: CA, K, 623, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qb6A (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn