Lineage for d1qb6a_ (1qb6 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1128615Protein Trypsin(ogen) [50515] (9 species)
  7. 1128633Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
    Uniprot P00760
  8. 1128940Domain d1qb6a_: 1qb6 A: [25939]
    complexed with 623, ca, k

Details for d1qb6a_

PDB Entry: 1qb6 (more details), 1.8 Å

PDB Description: bovine trypsin 3,3'-[3,5-difluoro-4-methyl-2, 6-pyridinediylbis(oxy)]bis(benzenecarboximidamide) (zk-805623) complex
PDB Compounds: (A:) protein (trypsin)

SCOPe Domain Sequences for d1qb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qb6a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1qb6a_:

Click to download the PDB-style file with coordinates for d1qb6a_.
(The format of our PDB-style files is described here.)

Timeline for d1qb6a_: