PDB entry 1qb2

View 1qb2 on RCSB PDB site
Description: crystal structure of the conserved subdomain of human protein srp54m at 2.1a resolution: evidence for the mechanism of signal peptide binding
Deposited on 1999-04-29, released 1999-10-12
The last revision prior to the SCOP 1.63 freeze date was dated 1999-10-12, with a file datestamp of 1999-10-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.245
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1qb2a_
  • Chain 'B':
    Domains in SCOP 1.63: d1qb2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qb2A (A:)
qftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsmndq
eldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qb2B (B:)
qftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsmndq
eldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkm