SCOP 1.63: Domain d1qb2a_: 1qb2 A:

Lineage for d1qb2a_ (1qb2 A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein SRP54M [47451] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47452] (2 PDB entries)

8. Domain d1qb2a_: 1qb2 A: [17125]

Details for d1qb2a_

PDB Entry: 1qb2, 2.1 Å

PDB Description: crystal structure of the conserved subdomain of human protein srp54m at 2.1a resolution: evidence for the mechanism of signal peptide binding

SCOP Domain Sequences for d1qb2a_:

Sequence; same for both SEQRES and ATOM records:

>d1qb2a_ a.36.1.1 (A:) SRP54M {Human (Homo sapiens)}
qftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsmndq
eldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvk

Timeline for d1qb2a_:

• d1qb2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qb2a_ appears in SCOP 1.61
  
• d1qb2a_ appears in SCOP 1.65
  
• d1qb2a_ appears in the current release, SCOPe 2.08