PDB entry 1qao

View 1qao on RCSB PDB site
Description: the structure of the rrna methyltransferase ermc': implications for the reaction mechanism
Deposited on 1999-03-26, released 2000-03-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-29, with a file datestamp of 2000-03-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qaoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qaoA (A:)
sqnfitskhnidkimtnirlnehdnifeigsgkghftlelvqrcnfvtaieidhklcktt
enklvdhdnfqvlnkdilqfkfpknqsykifgnipynistdiirkivfdsiadeiylive
ygfakrllntkrslalflmaevdisilsmvpreyfhpkpkvnsslirlnrkksrishkdk
qkynyfvmkwvnkeykkiftknqfnnslkhagiddlnnisfeqflslfnsyklfnk