PDB entry 1pih

View 1pih on RCSB PDB site
Description: the three dimensional structure of the paramagnetic protein hipip i from e.halophila through nuclear magnetic resonance
Deposited on 1994-08-03, released 1994-12-20
The last revision prior to the SCOP 1.55 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1pih__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pih_ (-)
  asepraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlv
  kaegwcsvyapas