PDB entry 1pdr

View 1pdr on RCSB PDB site
Description: crystal structure of the third pdz domain from the human homolog of discs large protein
Deposited on 1996-07-26, released 1997-07-23
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1pdr__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pdr_ (-)
  itreprkvvlhrgstglgfnivggedgegifisfilaggpadlsgelrkgdriisvnsvd
  lraasheqaaaalknagqavtivaqyrpeeysrqha