SCOPe 2.08: Structural Classification of Proteins

PDB entry 1pdf

View 1pdf on RCSB PDB site
Description: Fitting of gp11 crystal structure into 3D cryo-EM reconstruction of bacteriophage T4 baseplate-tail tube complex
Class: structural protein
Keywords: Structural protein
Deposited on 2003-05-19, released 2003-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfa_
Chain 'B':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfb_
Chain 'C':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfc_
Chain 'D':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfd_
Chain 'E':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfe_
Chain 'F':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdff_
Chain 'G':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfg_
Chain 'H':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfh_
Chain 'I':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfi_
Chain 'J':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfj_
Chain 'K':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfk_
Chain 'L':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfl_
Chain 'M':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfm_
Chain 'N':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfn_
Chain 'O':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfo_
Chain 'P':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfp_
Chain 'Q':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfq_
Chain 'R':
Compound: baseplate structural protein gp11
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
- Uniprot P10929 (Start-218)
Domains in SCOPe 2.08: d1pdfr_

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1pdfA (A:)
msllnnkagvisrladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvh
nfsikdvgtiitnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgm
taiefvakvrvalqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisq
eiiseskpgygtwnllgaqtvtldnqqtptvfyhferta