Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily) |
Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) |
Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein) |
Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries) |
Domain d1pdff_: 1pdf F: [94523] fitting of baseplate structural protein gp11 |
PDB Entry: 1pdf (more details)
SCOPe Domain Sequences for d1pdff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdff_ i.19.1.1 (F:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]} srladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvhnfsikdvgtii tnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgmtaiefvakvrv alqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisqeiiseskpgyg twnllgaqtvtldnqqtptvfyhferta
Timeline for d1pdff_: