Lineage for d1pdfm_ (1pdf M:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3045435Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. 3045436Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. 3045437Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. 3045438Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. 3045439Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries)
  8. 3045452Domain d1pdfm_: 1pdf M: [94530]
    fitting of baseplate structural protein gp11

Details for d1pdfm_

PDB Entry: 1pdf (more details)

PDB Description: fitting of gp11 crystal structure into 3d cryo-em reconstruction of bacteriophage t4 baseplate-tail tube complex
PDB Compounds: (M:) baseplate structural protein gp11

SCOPe Domain Sequences for d1pdfm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdfm_ i.19.1.1 (M:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]}
srladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvhnfsikdvgtii
tnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgmtaiefvakvrv
alqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisqeiiseskpgyg
twnllgaqtvtldnqqtptvfyhferta

SCOPe Domain Coordinates for d1pdfm_:

Click to download the PDB-style file with coordinates for d1pdfm_.
(The format of our PDB-style files is described here.)

Timeline for d1pdfm_: