PDB entry 1par

View 1par on RCSB PDB site
Description: dna recognition by beta-sheets in the arc repressor-operator crystal structure
Deposited on 1994-03-22, released 1994-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-02, with a file datestamp of 1999-02-02.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.225
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1para_
  • Chain 'B':
    Domains in SCOP 1.55: d1parb_
  • Chain 'C':
    Domains in SCOP 1.55: d1parc_
  • Chain 'D':
    Domains in SCOP 1.55: d1pard_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1parA (A:)
mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegrig

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1parB (B:)
mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1parC (C:)
mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegr

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1parD (D:)
mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga