PDB entry 1ox8
View 1ox8 on RCSB PDB site
Description: Crystal structure of SspB
Class: hydrolase activator
Keywords: RNA-binding property, HYDROLASE ACTIVATOR
Deposited on
2003-04-01, released
2003-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Stringent starvation protein B
Species: Escherichia coli [TaxId:83334]
Gene: SSPB OR B3228 OR Z4586 OR ECS4101
Database cross-references and differences (RAF-indexed):
- Uniprot P25663 (0-106)
- modified residue (38)
- modified residue (98)
Domains in SCOPe 2.06: d1ox8a_ - Chain 'B':
Compound: Stringent starvation protein B
Species: Escherichia coli [TaxId:83334]
Gene: SSPB OR B3228 OR Z4586 OR ECS4101
Database cross-references and differences (RAF-indexed):
- Uniprot P25663 (0-106)
- modified residue (38)
- modified residue (98)
Domains in SCOPe 2.06: d1ox8b_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ox8A (A:)
qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ox8B (B:)
qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd