SCOPe 2.06: Domain d1ox8a_: 1ox8 A:

Lineage for d1ox8a_ (1ox8 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.136: SspB-like [101737] (1 superfamily)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold

4. Superfamily b.136.1: SspB-like [101738] (3 families)

5. Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins)
   automatically mapped to Pfam PF04386

6. Protein Stringent starvation protein B, SspB [101740] (2 species)
   a specificity-enhancing factor for the ClpXP proteolytic machine

7. Species Escherichia coli [TaxId:562] [101741] (2 PDB entries)

8. Domain d1ox8a_: 1ox8 A: [93671]

Details for d1ox8a_

PDB Entry: 1ox8, 2.2 Å

PDB Description: Crystal structure of SspB

PDB Compounds: (A:) Stringent starvation protein B

SCOPe Domain Sequences for d1ox8a_:

Sequence; same for both SEQRES and ATOM records:

>d1ox8a_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Escherichia coli [TaxId: 562]}
qltprrpyllrafyewlldnqltphlvvdvtlpgvqvpmeyardgqivlniapravgnle
landevrfnarfggiprqvsvplaavlaiyarengagtmfepeaayd

Timeline for d1ox8a_:

• d1ox8a_ first appeared in SCOP 1.67
  
• d1ox8a_ appears in SCOPe 2.05
  
• d1ox8a_ appears in SCOPe 2.07
  
• d1ox8a_ appears in the current release, SCOPe 2.08