PDB entry 1opd

View 1opd on RCSB PDB site
Description: histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d)
Deposited on 1996-08-01, released 1997-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.182
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1opd__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1opd_ (-)
  mfeqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakdlfklqtlgltqgtv
  vtisaegedeqkavehlvklmaele