PDB entry 1n6j

View 1n6j on RCSB PDB site
Description: Structural basis of sequence-specific recruitment of histone deacetylases by Myocyte Enhancer Factor-2
Class: transcription/DNA
Keywords: MADS-box, Protein-DNA complex, histone deacetylases, TRANSCRIPTION-DNA COMPLEX
Deposited on 2002-11-11, released 2003-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2B OR XMEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n6ja_
  • Chain 'B':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2B OR XMEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n6jb_
  • Chain 'C':
    Compound: 5'-d(*ap*gp*cp*tp*ap*tp*tp*tp*ap*tp*ap*ap*gp*c)-3'
  • Chain 'D':
    Compound: 5'-d(*gp*cp*tp*tp*ap*tp*ap*ap*ap*tp*ap*gp*cp*t)-3'
  • Chain 'G':
    Compound: Calcineurin-binding protein Cabin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CABIN1 OR KIAA0330
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6jA (A:)
    grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
    mdrvllkyteysephesrtntdiletlkrrgig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n6jB (B:)
    grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
    mdrvllkyteysephesrtntdiletlkrrgig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6jB (B:)
    grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
    mdrvllkyteysephesrtntdiletlkrr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'G':
    No sequence available.