PDB entry 1myk

View 1myk on RCSB PDB site
Description: crystal structure, folding, and operator binding of the hyperstable arc repressor mutant pl8
Deposited on 1994-10-12, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1myka_
  • Chain 'B':
    Domains in SCOP 1.55: d1mykb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mykA (A:)
    kmlqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegrig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mykB (B:)
    kmlqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegr