PDB entry 1mjm

View 1mjm on RCSB PDB site
Description: methionine aporepressor mutant (q44k) complexed to half of the consensus operator sequence
Class: transcription/DNA
Keywords: transcription regulation, metj, methionine repressor, sheet-helix-helix, s-adenosyl methionine, DNA, complex (transcription regulation/DNA), transcription/DNA complex
Deposited on 1998-01-30, released 1999-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: methionine repressor
  Species: Escherichia coli [TaxId:562]
  Gene: METJ
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A8U6 (0-103)
    • engineered (43)
  Domains in SCOPe 2.06: d1mjma_
• Chain 'B':
  Compound: methionine repressor
  Species: Escherichia coli [TaxId:562]
  Gene: METJ
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A8U6 (0-103)
    • engineered (43)
  Domains in SCOPe 2.06: d1mjmb_
• Chain 'C':
  Compound: half consensus DNA operator duplex
  
• Chain 'D':
  Compound: half consensus DNA operator duplex
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mjmA (A:)
  aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
  flhaftgqplpddadlrkersdeipeaakeimremginpetwey
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mjmB (B:)
  aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
  flhaftgqplpddadlrkersdeipeaakeimremginpetwey
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.