SCOPe 2.06: Domain d1mjmb_: 1mjm B:

Lineage for d1mjmb_ (1mjm B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)
   automatically mapped to Pfam PF01340

6. Protein Met repressor, MetJ (MetR) [47607] (1 species)

7. Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)

8. Domain d1mjmb_: 1mjm B: [17473]
   protein/DNA complex; mutant

Details for d1mjmb_

PDB Entry: 1mjm, 2.2 Å

PDB Description: methionine aporepressor mutant (q44k) complexed to half of the consensus operator sequence

PDB Compounds: (B:) methionine repressor

SCOPe Domain Sequences for d1mjmb_:

Sequence; same for both SEQRES and ATOM records:

>d1mjmb_ a.43.1.5 (B:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

Timeline for d1mjmb_:

• d1mjmb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mjmb_ appears in SCOPe 2.05
  
• d1mjmb_ appears in SCOPe 2.07
  
• d1mjmb_ appears in the current release, SCOPe 2.08