PDB entry 1mdy
View 1mdy on RCSB PDB site
Description: crystal structure of myod bhlh domain bound to DNA: perspectives on DNA recognition and implications for transcriptional activation
Class: transcription/DNA
Keywords: protein-DNA complex, transcription/DNA complex
Deposited on
1994-06-09, released
1994-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.253
AEROSPACI score: 0.19
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (myod bhlh domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1mdya_ - Chain 'B':
Compound: protein (myod bhlh domain)
Species: Mus musculus [TaxId:10090]
Domains in SCOPe 2.07: d1mdyb_ - Chain 'C':
Compound: protein (myod bhlh domain)
Species: Mus musculus [TaxId:10090]
Domains in SCOPe 2.07: d1mdyc_ - Chain 'D':
Compound: protein (myod bhlh domain)
Species: Mus musculus [TaxId:10090]
Domains in SCOPe 2.07: d1mdyd_ - Chain 'E':
Compound: DNA (5'-d(*tp*cp*ap*ap*cp*ap*gp*cp*tp*gp*tp*tp*gp*a)-3')
- Chain 'F':
Compound: DNA (5'-d(*tp*cp*ap*ap*cp*ap*gp*cp*tp*gp*tp*tp*gp*a)-3')
- Chain 'G':
Compound: DNA (5'-d(*tp*cp*ap*ap*cp*ap*gp*cp*tp*gp*tp*tp*gp*a)-3')
- Chain 'H':
Compound: DNA (5'-d(*tp*cp*ap*ap*cp*ap*gp*cp*tp*gp*tp*tp*gp*a)-3')
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1mdyA (A:)
melkrkttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyie
glqallrd
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1mdyB (B:)
ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
rd
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1mdyC (C:)
ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
rd
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1mdyD (D:)
ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
rd
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.