PDB entry 1mdy

View 1mdy on RCSB PDB site
Description: crystal structure of myod bhlh domain bound to DNA: perspectives on DNA recognition and implications for transcriptional activation
Class: transcription/DNA
Keywords: protein-DNA complex, transcription/DNA complex
Deposited on 1994-06-09, released 1994-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.253
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (myod bhlh domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mdya_
  • Chain 'B':
    Compound: protein (myod bhlh domain)
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.07: d1mdyb_
  • Chain 'C':
    Compound: protein (myod bhlh domain)
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.07: d1mdyc_
  • Chain 'D':
    Compound: protein (myod bhlh domain)
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.07: d1mdyd_
  • Chain 'E':
    Compound: DNA (5'-d(*tp*cp*ap*ap*cp*ap*gp*cp*tp*gp*tp*tp*gp*a)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*tp*cp*ap*ap*cp*ap*gp*cp*tp*gp*tp*tp*gp*a)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*tp*cp*ap*ap*cp*ap*gp*cp*tp*gp*tp*tp*gp*a)-3')
  • Chain 'H':
    Compound: DNA (5'-d(*tp*cp*ap*ap*cp*ap*gp*cp*tp*gp*tp*tp*gp*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdyA (A:)
    melkrkttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyie
    glqallrd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdyB (B:)
    ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
    rd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdyC (C:)
    ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
    rd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mdyD (D:)
    ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
    rd
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.