Lineage for d1mdyd_ (1mdy D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323159Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 2323160Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 2323161Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins)
  6. 2323182Protein Myod B/HLH domain [47464] (1 species)
  7. 2323183Species Mouse (Mus musculus) [TaxId:10090] [47465] (1 PDB entry)
  8. 2323187Domain d1mdyd_: 1mdy D: [17135]
    protein/DNA complex

Details for d1mdyd_

PDB Entry: 1mdy (more details), 2.8 Å

PDB Description: crystal structure of myod bhlh domain bound to dna: perspectives on dna recognition and implications for transcriptional activation
PDB Compounds: (D:) protein (myod bhlh domain)

SCOPe Domain Sequences for d1mdyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdyd_ a.38.1.1 (D:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]}
ttnadrrkaatmrerrrlskvneafetlkrstssnpnqrlpkveilrnairyieglqall
rd

SCOPe Domain Coordinates for d1mdyd_:

Click to download the PDB-style file with coordinates for d1mdyd_.
(The format of our PDB-style files is described here.)

Timeline for d1mdyd_: