PDB entry 1m7l
View 1m7l on RCSB PDB site
Description: Solution Structure of the Coiled-Coil Trimerization Domain from Lung Surfactant Protein D
Class: sugar binding protein
Keywords: coiled coil, lung surfactant protein, trimer, ambiguous distance restraints, NMR-spectroscopy, SUGAR BINDING PROTEIN
Deposited on
2002-07-22, released
2002-11-27
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pulmonary surfactant-associated protein D
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1m7la_ - Chain 'B':
Compound: Pulmonary surfactant-associated protein D
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1m7lb_ - Chain 'C':
Compound: Pulmonary surfactant-associated protein D
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1m7lc_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1m7lA (A:)
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1m7lB (B:)
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1m7lC (C:)
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi