Lineage for d1m7la_ (1m7l A:)

  1. Root: SCOPe 2.02
  2. 1246834Class h: Coiled coil proteins [57942] (7 folds)
  3. 1246835Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1246836Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 1246837Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 1246909Protein Surfactant protein [57949] (2 species)
  7. 1246910Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (15 PDB entries)
  8. 1246953Domain d1m7la_: 1m7l A: [78735]

Details for d1m7la_

PDB Entry: 1m7l (more details)

PDB Description: solution structure of the coiled-coil trimerization domain from lung surfactant protein d
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d1m7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7la_ h.1.1.1 (A:) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi

SCOPe Domain Coordinates for d1m7la_:

Click to download the PDB-style file with coordinates for d1m7la_.
(The format of our PDB-style files is described here.)

Timeline for d1m7la_: