PDB entry 1m7k

View 1m7k on RCSB PDB site
Description: solution structure of the sodd bag domain
Deposited on 2002-07-22, released 2002-08-07
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-07, with a file datestamp of 2002-08-07.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1m7ka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m7kA (A:)
  tppsikkiihvlekvqyleqeveefvgkktdkaywlleemltkelleldsvetggqdsvr
  qarkeavckiqaileklekkg