Lineage for d1m7ka_ (1m7k A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.7: Spectrin repeat-like [46965] (7 superfamilies) 
Superfamily a.7.7: BAG domain [63491] (1 family) 
Family a.7.7.1: BAG domain [63492] (2 proteins)
this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain
Protein Silencer of death domains, Sodd (Bag4) [74699] (1 species) Species Human (Homo sapiens) [TaxId:9606] [74700] (2 PDB entries) 
Domain d1m7ka_: 1m7k A: [74573]
Details for d1m7ka_
PDB Entry: 1m7k (more details)
PDB Description: solution structure of the sodd bag domain
SCOP Domain Sequences for d1m7ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m7ka_ a.7.7.1 (A:) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens)}
tppsikkiihvlekvqyleqeveefvgkktdkaywlleemltkelleldsvetggqdsvr
qarkeavckiqaileklekkg
SCOP Domain Coordinates for d1m7ka_:
Click to download the PDB-style file with coordinates for d1m7ka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m7ka_:
- d1m7ka_ is new in SCOP 1.61
- d1m7ka_ appears in SCOP 1.63
- d1m7ka_ appears in the current release, SCOPe 2.08
View in 3D