PDB entry 1m6v

View 1m6v on RCSB PDB site
Description: Crystal Structure of the G359F (small subunit) Point Mutant of Carbamoyl Phosphate Synthetase
Class: ligase
Keywords: substrate channeling, tunnel, LIGASE
Deposited on 2002-07-17, released 2002-07-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbamoyl phosphate synthetase large chain
    Species: Escherichia coli [TaxId:562]
    Gene: CarB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968 (0-1072)
      • see remark 999 (45)
    Domains in SCOPe 2.02: d1m6va1, d1m6va2, d1m6va3, d1m6va4, d1m6va5, d1m6va6
  • Chain 'B':
    Compound: Carbamoyl-phosphate synthetase small chain
    Species: Escherichia coli [TaxId:562]
    Gene: CARA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00907
      • see remark 999 (182)
    Domains in SCOPe 2.02: d1m6vb1, d1m6vb2
  • Chain 'C':
    Compound: carbamoyl phosphate synthetase large chain
    Species: Escherichia coli [TaxId:562]
    Gene: CarB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968 (0-1072)
      • see remark 999 (45)
    Domains in SCOPe 2.02: d1m6vc1, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vc5, d1m6vc6
  • Chain 'D':
    Compound: Carbamoyl-phosphate synthetase small chain
    Species: Escherichia coli [TaxId:562]
    Gene: CARA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00907
      • see remark 999 (182)
    Domains in SCOPe 2.02: d1m6vd1, d1m6vd2
  • Chain 'E':
    Compound: carbamoyl phosphate synthetase large chain
    Species: Escherichia coli [TaxId:562]
    Gene: CarB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968 (0-1072)
      • see remark 999 (45)
    Domains in SCOPe 2.02: d1m6ve1, d1m6ve2, d1m6ve3, d1m6ve4, d1m6ve5, d1m6ve6
  • Chain 'F':
    Compound: Carbamoyl-phosphate synthetase small chain
    Species: Escherichia coli [TaxId:562]
    Gene: CARA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00907
      • see remark 999 (182)
    Domains in SCOPe 2.02: d1m6vf1, d1m6vf2
  • Chain 'G':
    Compound: carbamoyl phosphate synthetase large chain
    Species: Escherichia coli [TaxId:562]
    Gene: CarB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968 (0-1072)
      • see remark 999 (45)
    Domains in SCOPe 2.02: d1m6vg1, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vg5, d1m6vg6
  • Chain 'H':
    Compound: Carbamoyl-phosphate synthetase small chain
    Species: Escherichia coli [TaxId:562]
    Gene: CARA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00907
      • see remark 999 (182)
    Domains in SCOPe 2.02: d1m6vh1, d1m6vh2
  • Heterogens: MN, K, CL, PO4, ADP, ORN, NET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m6vA (A:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vA (A:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsame
    ivydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsac
    slpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvs
    katgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrst
    gevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldat
    hgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsal
    qykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m6vB (B:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspfp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vB (B:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspaap
    lfdhfielieqyrkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m6vC (C:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vC (C:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsame
    ivydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsac
    slpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvs
    katgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrst
    gevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldat
    hgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsal
    qykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1m6vD (D:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspfp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vD (D:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspaap
    lfdhfielieqyrkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1m6vE (E:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vE (E:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsame
    ivydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsac
    slpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvs
    katgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrst
    gevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldat
    hgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsal
    qykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1m6vF (F:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspfp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vF (F:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspaap
    lfdhfielieqyrkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1m6vG (G:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vG (G:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsame
    ivydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsac
    slpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvs
    katgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrst
    gevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldat
    hgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsal
    qykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1m6vH (H:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspfp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vH (H:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspaap
    lfdhfielieqyrkt