Lineage for d1m6vd2 (1m6v D:153-380)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1160006Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1160007Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 1160018Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 1160019Species Escherichia coli [TaxId:562] [52322] (10 PDB entries)
    Uniprot P00907
  8. 1160049Domain d1m6vd2: 1m6v D:153-380 [74551]
    Other proteins in same PDB: d1m6va1, d1m6va2, d1m6va3, d1m6va4, d1m6va5, d1m6va6, d1m6vb1, d1m6vc1, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vc5, d1m6vc6, d1m6vd1, d1m6ve1, d1m6ve2, d1m6ve3, d1m6ve4, d1m6ve5, d1m6ve6, d1m6vf1, d1m6vg1, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vg5, d1m6vg6, d1m6vh1
    complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1m6vd2

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase
PDB Compounds: (D:) Carbamoyl-phosphate synthetase small chain

SCOPe Domain Sequences for d1m6vd2:

Sequence, based on SEQRES records: (download)

>d1m6vd2 c.23.16.1 (D:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspfphdaaplfdhfielieqyrkt

Sequence, based on observed residues (ATOM records): (download)

>d1m6vd2 c.23.16.1 (D:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspaaplfdhfielieqyrkt

SCOPe Domain Coordinates for d1m6vd2:

Click to download the PDB-style file with coordinates for d1m6vd2.
(The format of our PDB-style files is described here.)

Timeline for d1m6vd2: