PDB entry 1l5g

View 1l5g on RCSB PDB site
Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand
Class: cell adhesion
Keywords: genu, hybrid domain, beta-tail domain, psi domain, egf domain, midas, admidas, limbs, cage motif, propeller, a-domain, thigh domain, calf domain, rgd ligand, cell adhesion
Deposited on 2002-03-06, released 2002-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.248
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin alpha v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB XP_002379 (0-End)
    Domains in SCOPe 2.07: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4
  • Chain 'B':
    Compound: integrin beta-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l5gb1, d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5
  • Chain 'C':
    Compound: cyclic arg-gly-asp peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1L5G (0-4)
  • Heterogens: NAG, MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l5gA (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcgedn
    vckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnn
    ealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqss
    nlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiy
    elrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdmeinplrikisslqt
    tekndtvagqgerdhlitkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvk
    sllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvttnvtwgiqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5gA (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcgedn
    vckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnn
    ealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqss
    nlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiy
    elrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdmeinplrikissldi
    htlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhsyslkssasfnvi
    efpyknlpieditnstlvttnvtwgiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l5gB (B:)
    gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefpvse
    arvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdiyylmdl
    sysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppealenpcydm
    kttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcdekigwrn
    dashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslglmtekls
    qkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirskvelevr
    dlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvg
    fkdslivqvtfdcdcacqaqaepnshrcnngngtfecgvcrcgpgwlgsqcecseedyrp
    sqqdecspregqpvcsqrgeclcgqcvchssdfgkitgkycecddfscvrykgemcsghg
    qcscgdclcdsdwtgyycncttrtdtcmssngllcsgrgkcecgscvciqpgsygdtcek
    cptcpdactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykne
    ddcvvrfqyyedssgksilyvveepecpkgpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5gB (B:)
    efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdi
    yylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppeale
    npcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcde
    kigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslgl
    mteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirsk
    velevrdlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksf
    tikpvgfkdslivqvtfdcdkgemcsghgqcscgdclcdsdwtgyycncttrtdtcmssn
    gllcsgrgkcecgscvciqpgsygdtcekcptcpdactfkkecveckkfdrepymtentc
    nrycrdeiesvkelkdtgkdavnctykneddcvvrfqyyedssgksilyvveepecpkg
    

  • Chain 'C':
    No sequence available.