Lineage for d1l5ga3 (1l5g A:738-956)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764933Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2764934Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 2764948Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 2764949Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries)
    Uniprot P06756 31-986
  8. 2764961Domain d1l5ga3: 1l5g A:738-956 [73583]
    Other proteins in same PDB: d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5
    complexed with mn, nag

Details for d1l5ga3

PDB Entry: 1l5g (more details), 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand
PDB Compounds: (A:) integrin alpha v

SCOPe Domain Sequences for d1l5ga3:

Sequence, based on SEQRES records: (download)

>d1l5ga3 b.1.15.1 (A:738-956) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikisslqttekndtvagqgerdhli
tkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhs
yslkssasfnviefpyknlpieditnstlvttnvtwgiq

Sequence, based on observed residues (ATOM records): (download)

>d1l5ga3 b.1.15.1 (A:738-956) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikissldihtlgcgvaqclkivcqv
grldrgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstl
vttnvtwgiq

SCOPe Domain Coordinates for d1l5ga3:

Click to download the PDB-style file with coordinates for d1l5ga3.
(The format of our PDB-style files is described here.)

Timeline for d1l5ga3: