Lineage for d1l5gb3 (1l5g B:606-690)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2562879Fold d.200: Integrin beta tail domain [69686] (1 superfamily)
    alpha-beta-loop-beta(3); loop across free side of beta-sheet
  4. 2562880Superfamily d.200.1: Integrin beta tail domain [69687] (1 family) (S)
    automatically mapped to Pfam PF07965
  5. 2562881Family d.200.1.1: Integrin beta tail domain [69688] (1 protein)
  6. 2562882Protein Integrin beta tail domain [69689] (1 species)
  7. 2562883Species Human (Homo sapiens) [TaxId:9606] [69690] (4 PDB entries)
    Uniprot P05106 27-716
  8. 2562885Domain d1l5gb3: 1l5g B:606-690 [73587]
    Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb4, d1l5gb5
    complexed with mn, nag

Details for d1l5gb3

PDB Entry: 1l5g (more details), 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1l5gb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5gb3 d.200.1.1 (B:606-690) Integrin beta tail domain {Human (Homo sapiens) [TaxId: 9606]}
dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv
rfqyyedssgksilyvveepecpkg

SCOPe Domain Coordinates for d1l5gb3:

Click to download the PDB-style file with coordinates for d1l5gb3.
(The format of our PDB-style files is described here.)

Timeline for d1l5gb3: