PDB entry 1ky9

View 1ky9 on RCSB PDB site
Description:
Deposited on 2002-02-04, released 2002-04-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ky9A (A:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqegspfqsspfcq
    ggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdgrkfdakmvgk
    dprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsgivsalgrsgl
    naenyenfiqtdaainrgnaggalvnlngeligintailapdggnigigfaipsnmvknl
    tsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvi
    tslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky9A (A:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrsgyenfiqtdaainrgnaggalvnlngeli
    gintailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkv
    daqrgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgll
    rdgkqvnvnle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ky9B (B:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqegspfqsspfcq
    ggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdgrkfdakmvgk
    dprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsgivsalgrsgl
    naenyenfiqtdaainrgnaggalvnlngeligintailapdggnigigfaipsnmvknl
    tsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvi
    tslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqnqvdsssifng
    iegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniaelrkvldskps
    vlalniqrgdstiyll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky9B (B:)
    qmpslapmlekvmpsvvsinvegsttvntprmprnfqqffggqqqkfmalgsgviidadk
    gyvvtnnhvvdnatvikvqlsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsda
    lrvgdytvaignpfglgetvtsgivsalgrenfiqtdaainrgnaggalvnlngeligin
    tailapdggnigigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaq
    rgafvsqvlpnssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdg
    kqvnvnlelqqssqnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiga
    nqqavkniaelrkvldskpsvlalniqrgdstiyll