PDB entry 1kug

View 1kug on RCSB PDB site
Description: crystal structure of a taiwan habu venom metalloproteinase complexed with its endogenous inhibitor penw
Deposited on 2002-01-22, released 2002-07-10
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-10, with a file datestamp of 2002-07-10.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.172
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kuga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kugA (A:)
qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcttcimsavisdkqsklfsdc
skdyyqtfltndnpqcilnap