Lineage for d1kuga_ (1kug A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.9: Hemorrhagin [55519] (1 protein) Protein Snake venom metalloprotease [55520] (5 species) Species Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId:103944] [75495] (4 PDB entries) 
Domain d1kuga_: 1kug A: [73008]
Details for d1kuga_
PDB Entry: 1kug (more details), 1.37 Å
PDB Description: crystal structure of a taiwan habu venom metalloproteinase complexed with its endogenous inhibitor penw
SCOP Domain Sequences for d1kuga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kuga_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E}
qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcttcimsavisdkqsklfsdc
skdyyqtfltndnpqcilnap
SCOP Domain Coordinates for d1kuga_:
Click to download the PDB-style file with coordinates for d1kuga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kuga_:
- d1kuga_ is new in SCOP 1.61
- d1kuga_ appears in SCOP 1.63
- d1kuga_ appears in the current release, SCOPe 2.08
View in 3D