PDB entry 1kp6

View 1kp6 on RCSB PDB site
Description: ustilago maydis killer toxin kp6 alpha-subunit
Deposited on 1999-05-28, released 1999-07-21
The last revision prior to the SCOP 1.55 freeze date was dated 1999-07-21, with a file datestamp of 1999-07-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1kp6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kp6A (A:)
  nnafcagfglsckwecwctahgtgnelryataagcgdhlsksyydaraghclfsddlrnq
  fyshcsslnnnmscrslsk