PDB entry 1kfd

View 1kfd on RCSB PDB site
Description: crystal structures of the klenow fragment of dna polymerase i complexed with deoxynucleoside triphosphate and pyrophosphate
Deposited on 1993-09-23, released 1994-06-22
The last revision prior to the SCOP 1.55 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 3.9 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1kfd_ (-)
    visydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpggapstseevleelaldypl
    pkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrn
    eegrrirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfg
    lpletvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleyme
    rtraqakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiav
    dawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgen
    wdqah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfd_ (-)
    visydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiadyplpkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgr
    lsstdpnlqnipvrneegrrirqafiapedyvivsadysqielrimahlsrdkglltafa
    egkdihrataaevfglpletvtseqrrsakainfgliygmsafglarqlniprkeaqkym
    dlyferypgvleymertraqakeqgyvetldgrrlylpdikssngarraaaeraainapm
    qgtaadiikramiavdawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenct
    rldvpllvevgsgenwdqah