PDB entry 1k5d

View 1k5d on RCSB PDB site
Description: Crystal structure of Ran-GPPNHP-RanBP1-RanGAP complex
Deposited on 2001-10-10, released 2002-02-13
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.237
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1k5da_
  • Chain 'B':
    Domains in SCOP 1.59: d1k5db_
  • Chain 'C':
    Domains in SCOP 1.59: d1k5dc_
  • Chain 'D':
    Domains in SCOP 1.59: d1k5dd_
  • Chain 'E':
    Domains in SCOP 1.59: d1k5de_
  • Chain 'F':
    Domains in SCOP 1.59: d1k5df_
  • Chain 'G':
    Domains in SCOP 1.59: d1k5dg_
  • Chain 'H':
    Domains in SCOP 1.59: d1k5dh_
  • Chain 'I':
    Domains in SCOP 1.59: d1k5di_
  • Chain 'J':
    Domains in SCOP 1.59: d1k5dj_
  • Chain 'K':
    Domains in SCOP 1.59: d1k5dk_
  • Chain 'L':
    Domains in SCOP 1.59: d1k5dl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dA (A:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqttalpded
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dB (B:)
    nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
    ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
    flnaenaqkfktkfeecrkeieerek
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dC (C:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dD (D:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqttalpded
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dE (E:)
    nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
    ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
    flnaenaqkfktkfeecrkeieerek
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dF (F:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dG (G:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqttalpded
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dH (H:)
    nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
    ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
    flnaenaqkfktkfeecrkeieerek
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dI (I:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dJ (J:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqttalpded
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dK (K:)
    nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
    ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
    flnaenaqkfktkfeecrkeieerek
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5dL (L:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee