Lineage for d1k5dd_ (1k5d D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122094Protein Ran [52609] (2 species)
  7. 122108Species Human (Homo sapiens) [TaxId:9606] [52611] (6 PDB entries)
  8. 122114Domain d1k5dd_: 1k5d D: [68171]
    Other proteins in same PDB: d1k5db_, d1k5dc_, d1k5de_, d1k5df_, d1k5dh_, d1k5di_, d1k5dk_, d1k5dl_

Details for d1k5dd_

PDB Entry: 1k5d (more details), 2.7 Å

PDB Description: Crystal structure of Ran-GPPNHP-RanBP1-RanGAP complex

SCOP Domain Sequences for d1k5dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5dd_ c.37.1.8 (D:) Ran {Human (Homo sapiens)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpded

SCOP Domain Coordinates for d1k5dd_:

Click to download the PDB-style file with coordinates for d1k5dd_.
(The format of our PDB-style files is described here.)

Timeline for d1k5dd_: