PDB entry 1jzn

View 1jzn on RCSB PDB site
Description: crystal structure of a galactose-specific C-type lectin
Class: sugar binding protein
Keywords: C-type lectin, protein-disaccharide complex, SUGAR BINDING PROTEIN
Deposited on 2001-09-16, released 2003-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose-specific lectin
    Species: Crotalus atrox [TaxId:8730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jzna_
  • Chain 'B':
    Compound: Galactose-specific lectin
    Species: Crotalus atrox [TaxId:8730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jznb_
  • Chain 'C':
    Compound: Galactose-specific lectin
    Species: Crotalus atrox [TaxId:8730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jznc_
  • Chain 'D':
    Compound: Galactose-specific lectin
    Species: Crotalus atrox [TaxId:8730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jznd_
  • Chain 'E':
    Compound: Galactose-specific lectin
    Species: Crotalus atrox [TaxId:8730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jzne_
  • Heterogens: CA, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jznA (A:)
    nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
    kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
    qvceskdaflcqckf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jznB (B:)
    nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
    kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
    qvceskdaflcqckf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jznC (C:)
    nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
    kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
    qvceskdaflcqckf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jznD (D:)
    nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
    kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
    qvceskdaflcqckf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jznE (E:)
    nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
    kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
    qvceskdaflcqckf